Sharky Forums Folding Team

Quote:

---

Originally posted by RealBeast
Yup, with nothing else running, two instances on my HT machines run 12-15% faster than one at a time. I have to kill one console to do anything else other than web surfing though, because the machines are real sluggish with 2 running.

I added 3 more 2GHz P4s a couple days ago and they're starting to contribute better now that they got through the Tinkers that they all got to start. Tinkers take at least twice the time per point compared to Gromacs on my machines. Fortunately, right now I have none of them. :)

Is EOC down?

---

If you mean the EOC folding stats, its just updating.

This is interesting. I've less WUs than anyone ahead of me, but several folders behind me have more WUs but fewer points. Am I just getting somewhat more difficult WUs and worth more points. Am I being picked on :D

Quote:

---

Originally posted by lonewolfroger
If you mean the EOC folding stats, its just updating.

---

Ah good, I keep getting page not found -- but I'm on [pain] dialup [/pain] for a few weeks at my temporary residence. :(

Quote:

---

Originally posted by OS-Wiz
This is interesting. I've less WUs than anyone ahead of me, but several folders behind me have more WUs but fewer points. Am I just getting somewhat more difficult WUs and worth more points. Am I being picked on :D

---

Even in the Gromacs, the effort is not always directly proportional to the points. Yesterday, I did a 53.7 pt WU that took almost 20% longer that a 51.4 pt WU. Tinkers are the real killer though.

Quote:

---

Originally posted by RealBeast
Ah good, I keep getting page not found -- but I'm on [pain] dialup [/pain] for a few weeks at my temporary residence. :(

---

You should be getting the update page, I got it on dialup.

Quote:

---

Originally posted by lonewolfroger
You should be getting the update page, I got it on dialup.

---

Wolfman, I thought you finally had dsl/cable modem?

Quote:

---

Originally posted by OS-Wiz
Wolfman, I thought you finally had dsl/cable modem?

---

I do but it looks like Real Beast will be on dialup for a couple of weeks, but I was stating he should be getting the EOC update page even on dial up, not page not found.

Quote:

---

Originally posted by RealBeast
Even in the Gromacs, the effort is not always directly proportional to the points. Yesterday, I did a 53.7 pt WU that took almost 20% longer that a 51.4 pt WU. Tinkers are the real killer though.

---

Not only that... Some people have a unstable overclock which are stopping F&H from completing that WU... You will still get partial credit for the work completed...

Not sure if any of you guys have seen these before:

Protein Name: DES2/pdb1jau.51
Genome core.

I'm 33% through it, with 21 hours to go on a P4 2.4B.
The worst thing is that according to F@H Logstats it's worth 20.90 points....

It's a 600, by the way. I've gone through a few 5000's, but that's nothing compared to this fella.

Quote:

---

Originally posted by Mojo
Not sure if any of you guys have seen these before:

Protein Name: DES2/pdb1jau.51
Genome core.

I'm 33% through it, with 21 hours to go on a P4 2.4B.
The worst thing is that according to F@H Logstats it's worth 20.90 points....

It's a 600, by the way. I've gone through a few 5000's, but that's nothing compared to this fella.

---

WOW.. I probably would of canned that protein a long time ago :D

Quote:

---

Originally posted by Mojo
. . . Protein Name: DES2/pdb1jau.51
Genome core.

I'm 33% through it, with 21 hours to go on a P4 2.4B.
The worst thing is that according to F@H Logstats it's worth 20.90 points....

---

Ouch. I selected FAH in advanced settings so I don't get the genome WUs, that sounds as bad or worse than tinkers.

Further to that, here's an excerpt from the log file:
[14:35:49] [SPG] seed: 16270578
[14:35:49] [SPG] Designing protein sequence 3 of 30
[14:42:49] [SPG] 10.0
[14:49:29] [SPG] 20.0
[14:55:56] [SPG] 30.0
[15:02:13] [SPG] 40.0
[15:08:19] [SPG] 50.0
[15:14:22] [SPG] 60.0
[15:20:13] [SPG] 70.0
[15:23:04] + Working...
[15:25:58] [SPG] 80.0
[15:31:44] [SPG] 90.0
[15:37:24] [SPG] 100.0
[15:37:24] [SPG] Writing current.xyz
[15:37:24] [SPG] Sequence 3 completed:
[15:37:24] SRVPPQKFKSQQIEQAEQTSTKFQLLDSEEEKKQLYLVNVYGPJESALTN . . .
[15:37:24] Iterations: 60 of 600
[15:37:25] Finished

Colossus - It kicked in over the weekend, so when I got into work it was already at 30%. Plus, it's there for a reason - it wouldn't be downloaded if it wasn't important work. Even with that I pushed out over 500 points in the last 24 hours anyway, although the temptation to go for broke and catch Saps ASAP was very strong :)

Edited in an attempt to not sound like a pompous git :)

Quote:

---

Originally posted by Mojo
MarkO of the Sharky Folding Team

---

Don't you mean Makr0? ;)

[QUOTE]Originally posted by RealBeast
Ah good, I keep getting page not found -- but I'm on [pain] dialup [/pain] for a few weeks at my temporary residence. :( [

I am to. i am on DSL?

Quote:

---

Originally posted by Thermo
I was just looking at Statman, and I see that our Leader is still clinging to the top 10. IIRC, some of you guys were talking about passing him right after the new year. What happened? You guys slacking off or something?

---

Speaking of slacking off, did the stack go down? Or are you just trying to let me get back to within 10k of ya? :D

well dangit. used to be in the top 25...now i'm in the top 45. dangit. and i still won't be able to get back to my computer for another couple of days...oh well. such is life. great to see the team doing so well! congratulations all around for spot number 75 and passing up chicagogamers!! :)

sounds like some wierd stuff has been going on with the tinkers, gromacs, etc. has it seemed to be ironed out yet? or still wierd things happening? just curious.

Quote:

---

Originally posted by schultz
well dangit. used to be in the top 25...now i'm in the top 45. dangit. and i still won't be able to get back to my computer for another couple of days...oh well. such is life. great to see the team doing so well! congratulations all around for spot number 75 and passing up chicagogamers!! :)

sounds like some wierd stuff has been going on with the tinkers, gromacs, etc. has it seemed to be ironed out yet? or still wierd things happening? just curious.

---

I don`t know of anything weird going on, but they have come out with some new gromacs, that take almost as long as a tinker to fold.

Quote:

---

Originally posted by lonewolfroger
I don`t know of anything weird going on, but they have come out with some new gromacs, that take almost as long as a tinker to fold.

---

when i said "wierd" i was referring to all the people getting the tinkers even with -advmethods. was this determined to be a server thing? and i've heard about those new gromacs. look like killers.

Quote:

---

Originally posted by schultz
when i said "wierd" i was referring to all the people getting the tinkers even with -advmethods. was this determined to be a server thing? and i've heard about those new gromacs. look like killers.

---

Yes, I believe that was a server thing or they just needed to get some tinkers done. I got a tinker on each of my computers, but have only got gromacs afterwards.

Quote:

---

Originally posted by lonewolfroger
Yes, I believe that was a server thing or they just needed to get some tinkers done. I got a tinker on each of my computers, but have only got gromacs afterwards.

---

alright. thanks man. just kind of looking for information soon. want to be prepared for when i start it back up. nice to know about things in advance, rather than get there and be like...what the?!!

Well, I have come to the decision that Nix is not up to folding 24/7, at least not with VIA chip sets. I thought it might be a cheap board/Via problem, but a little test disproved this. I put Windows on one of the 3000+’s and set it to auto reboot every 48 hours, and left Redhat on the other four and set them to reboot every 24 hours. The box with 2K/AS on it is still running, the other four are on but not accepting connections. Strange thing is that I have a 2.4 Northwood on an 850 Intel board with Redhat. It is set to reboot every 48 hours and has been running fine for a few weeks now. Soon as I can pick up 4 Windows licences, I think I'll can the Redhat on the 3000+'s.


Also, they seem to be force feeding us some special work units the last week or so. I found two of them that had gone into a loop, and the log just showed repeated entries that said “working” although no progress was being made on them.

Correct me if I’m wrong, but I seem to recall some of you saying that you were about to kick Sapasion out of the top 10. What's the hold up? You guys taking it easy on him or something?

Quote:

---

Originally posted by Thermo
Well, I have come to the decision that Nix is not up to folding 24/7, at least not with VIA chip sets....

Also, they seem to be force feeding us some special work units the last week or so. I found two of them that had gone into a loop, and the log just showed repeated entries that said “working” although no progress was being made on them.

---

i had that same problem a week or so ago, with that hanging at the "working" screen. i deleted the core and that fixed it. most of my other problems with linux have been because of using the windows client through the wine program, where my system became unstable or had some problem with the wine installation after upgrading to the 2.6.x kernel, which caused a lot of WUs to get dropped in succession (i've probably got the highest point to WU ratio of any sharky folder :p). that hanging problem was after going to 2.6.0, also, come to think of it.

otherwise, i haven't really had any trouble folding on linux, except for getting more tinkers a few months ago because the gromacs for linux ran out (which is why i started using wine). but that situation seems to be resolved now, and i haven't gotten a tinker since. what kernel version are you running, and which version of folding? i've been using the linux 4.00 client for about 2-3 weeks -- no problems. i have a nf2 mobo, however, so it's possible it's a VIA chipset problem. and i suppose it could have something to do with red hat, too, it's really hard to say. you should try another distro before concluding it's a general linux problem, it might just be red hat specific. but if you find windows just works better for your hardware, i would say definitely go with that, if you don't mind shelling out for the licenses. :D (personally, i would GET it to work on linux rather than do that. :p but that's just me. :D)

I have some XP licenses, but I would like to hold on to them. I’ll hit the flea market and try to pick up some junk with 2k on it.

I don’t recall the kernel ver. off the top of my head, but 2.6something rings a bell. I use the 3.25 folding client on all of my AMD boxes.

Quote:

---

Originally posted by Thermo
I have some XP licenses, but I would like to hold on to them. I’ll hit the flea market and try to pick up some junk with 2k on it.

I don’t recall the kernel ver. off the top of my head, but 2.6something rings a bell. I use the 3.25 folding client on all of my AMD boxes.

---

Why do you have the server reboot so often?

I have a Slackware box crunching here and I havent rebooted it for the last 4 months!